Skip to content

masa-ue/ProDifEvo-Refinement

Repository files navigation

Description

This repository contains the code accompanying our paper in XXX. We propose a method that integrates pre-trained discrete diffusion models (e.g., EvoDiff) for protein sequences with reward models (i.e., seq → target property) at test time for computational protein design. Our algorithm effectively optimizes the reward function while retaining sequence naturalness characterzied by pre-trained diffusion models. Unlike existing single-shot guided approaches in diffusion models, our method uses an iterative refinement approach inspired by evolutionary algorithms, alternating between (derivative-free) reward-guided denoising and noising.

Below are examples of trajectories obtained when optimizing structural properties as rewards

Generated Proteins

We present results on optimizing several fundamental structural rewards, including symmetry, globularity, match_ss, crmsd. We can further optimize ptm,plddt,tm,lddt,hydrophobic,surface_expose. All rewards are defined based on the outputs of a sequence-to-structure model using ESMFold. Below, we visualize examples of the generated sequences, where ESMFold is used to predict their structures.


Instructions for Running the Code

CUDA_VISIBLE_DEVICES=0 python refinement.py

Run the above command with additional options. Below is an explanation of the available options.

  • --decoding: decoding method e.g., SVDD_edit (our proposal in the paper), SVDD (single-shot generation)
  • --repeatnum: batch size
  • --duplicate: important hyperparameters in decoding methods for each cycle. It reflects how many states we replicate (e.g., 20). This is the width of the tree (Refer to SVDD).
  • --metrics_name: reward function. We have tm, globularity, plddt, ptm, hydrophobic, symmetry, globularity, match_ss, crmsd, ptm,plddt,tm,lddt,hydrophobic,surface_expose.
  • --metrics_list: how to set weights for the above rewards. For example, --metric_name match_ss,crmsd,plddt --metrics_list 1,1,1 means we optimize match_ss + crmsd + plddt.
  • --proteinname: In tasks such as match_ss, crmsd, tm, we can set some target structure in a pdb format in the folder ./datasets/AlphaFold_model_PDBs (e.g., 5KPH, XX:run1_0367_0004, etc.)
  • --iteraiton: number of iterations in our proposal (e.g., 20)
  • --seq_length: length of proteins we want to design
  • --edit_seqlength: How much portion of the sequence we edit (e.g., 0.5$)

1. Symmetry

Design symmetric proteins with sevenfold symmetry.

CUDA_VISIBLE_DEVICES=3 python refinement.py --decoding SVDD_edit  --repeatnum 10 --duplicate 20 --seq_length 30 --metrics_name symmetry,hydrophobic,plddt --metrics_list 1,1,1 --iteration 20 --num_symmetry 7

2. Globularity

Design globular proteins.

CUDA_VISIBLE_DEVICES=2 python refinement.py --decoding SVDD_edit  --repeatnum 10 --duplicate 20  --metrics_name globularity,plddt  --metrics_list 1,1 --iteration 20 --seq_length 150

3. cRMSD

Design a sequence that folds into a target structure based on cRMSD.

CUDA_VISIBLE_DEVICES=3 python refinement.py --decoding SVDD_edit  --repeatnum 20 --duplicate 20  --metrics_name crmsd  --metrics_list 1 --proteinname 5KPH --iteration 40

4. SS (secondary structure) match

Design a sequence that folds into a target secondary structure.

CUDA_VISIBLE_DEVICES=4 python refinement.py --decoding SVDD_edit  --repeatnum 10 --duplicate 20  --metrics_name match_ss  --metrics_list 1 --proteinname r15_96_TrROS_Hall --iteration 30

5. TM score

Design a sequence that folds into a target structure based on the TM-score.

CUDA_VISIBLE_DEVICES=5 python refinement.py --decoding SVDD_edit  --repeatnum 10 --duplicate 20  --metrics_name tm  --metrics_list 1 --proteinname 5KPH --iteration 30

Editting Sequences

When we want to edit existing sequences, set --seed_design as True, and --initial_seq as a protein sequence. The following is an example when optimizing symmetry.

CUDA_VISIBLE_DEVICES=6 python refinement.py --decoding SVDD_edit  --repeatnum 10 --duplicate 20 --metrics_name crmsd,plddt,hydrophobic --proteinname r15_96_TrROS_Hall --metrics_list 1,1,1 --iteration 20 --seed_design True --initial_seq MMELEIEIKVEGMTEEELRELAERLAAELTPEGWKVVAVRVERVDEEEGVVRVTVVVEPV  

Outputs

Refer to the notebook medias/evaluate.ipynb. PDB files of batches and important metrics are saved at each iteration.


Installation

Install pytroch, pyrosseta. Then, run the following

conda create -n RERD python=3.9 
conda activate RERD
pip3 install torch torchvision torchaudio
pip3 install -r requirements.txt

Also, to optimize match_ss, crmsd, go to the ./datasets folder and download examples of proteins as follows.

python download_model_data.py

This code puts several pdb files into ./datasets/AlphaFoldPDB/. But, technicallly, you can put any pdb files.


Acknolwdgements

Our codebase is heavily based on evodiff, openfold, ESMfold.


About

Evolutionary Algorithm with Diffusion Models for Protein Design

Topics

Resources

Stars

Watchers

Forks

Releases

No releases published

Packages

 
 
 

Contributors