Skip to content
 
 

Repository files navigation

UniKP

GitHub release (latest by date including pre-releases) GitHub last commit GitHub issues GitHub pull requests GitHub

Feel free to contact me via email at yuhanid147@gmail.com if you encounter any issues or have any questions.

Introduction of UniKP

Prediction of enzyme kinetic parameters is essential for designing and optimizing enzymes for various biotechnological and industrial applications, but the limited performance of current prediction tools on diverse tasks hinders their practical applications. Here, we introduce UniKP, a unified framework based on pretrained language models for the prediction of enzyme kinetic parameters, including enzyme turnover number (kcat), Michaelis constant (Km), and catalytic efficiency (kcat / Km), from protein sequences and substrate structures. A two-layer framework derived from UniKP (EF-UniKP) has also been proposed to allow robust kcat prediction in considering environmental factors, including pH and temperature. In addition, four representative re-weighting methods are systematically explored to successfully reduce the prediction error in high-value prediction tasks. We have demonstrated the application of UniKP and EF-UniKP in several enzyme discovery and directed evolution tasks, leading to the identification of new enzymes and enzyme mutants with higher activity. UniKP is a valuable tool for deciphering the mechanisms of enzyme kinetics and enables novel insights into enzyme engineering and their industrial applications.

Here is the framework of UniKP

Applications of UniKP

This table summarizes representative progress made by uniKP in enzyme mining and evolution across diverse metabolic pathways and engineering applications, including the construction of high-efficiency biosynthesis platforms and the optimization of heterologous pathways. It provides a clear overview of the literature, enzyme types, target parameters, and applied mining/evolution strategies, serving as a quick reference for researchers. We also welcome broad collaboration with experimental biologists.

DOI Journal Application Enzyme Target Parameters Mining / Evolution
10.1016/j.tibtech.2025.07.016 Trends Biotechnol. High-efficiency NeuAc biosynthesis N-acetylglucosamine 2-epimerase (AGE)
NeuAc synthase (NeuB)
kcat Enzyme mining
10.1002/advs.202512736 Adv Sci. High-efficiency chrysanthemic acid biosynthesis in E. coli Farnesyl diphosphate synthase (ispA) kcat / km Enzyme mining
10.1111/jipb.70048 J Integr Plant Biol. De novo biosynthesis of irregular methyl β-elemene in microbes C-methyltransferase (C-MT)
Germacrene A synthase (NpGAS)
kcat / km Enzyme mining / evolution
10.1021/acscatal.5c07044 ACS Catal. Stereoselective synthesis of chiral N-heterocyclic amines with nonadjacent stereocenters ω-Transaminase (AlTA, engineered mutant M3) kcat / km Enzyme mining
10.1016/j.ymben.2025.11.015 Metab Eng. Novel amino acid-derived malonyl-CoA pathways for enhanced polyketide and lipid production in Yarrowia lipolytica L-glutamate dioxygenase (IboH)
Aldolase (LtaE)
Monoamine oxidase (MAO)
Malonyl-CoA reductase C-terminal (MCR-C)
kcat / km Enzyme mining
10.1016/j.ymben.2025.01.006 Metab Eng. De novo biosynthesis of 10-hydroxy-2-decenoic acid in Escherichia coli CYP153AMaq kcat / km Enzyme evolution
10.1021/acs.jafc.5c04270 J Agric Food Chem. NLactulose production via lactose isomerization Dictyoglomus thermophilum cellobiose 2-epimerase (DithCE) kcat / km Enzyme evolution
10.1016/j.ijbiomac.2025.140313 Int J Biol Macromol. Enhanced ortho‑hydroxylation for salvianic acid A (SAA) biosynthesis 4‑Hydroxyphenylacetate‑3‑hydroxylase (EcHpaB) kcat / km Enzyme evolution
10.3390/catal14120905 Catalysts GABA production from MSG at neutral pH Glutamate decarboxylase kcat Enzyme evolution
10.1101/2024.09.02.610684 bioRxiv Comprehensive exploration of yeast underground metabolism and prediction of by-products for native and heterologous compounds 2,057 yeast metabolic enzymes kcat None / Metabolic networks
... ... ... ... ... ...

Demo-Preview

  • For users who want to know what to expect in this project, as follows:

    • (1). Out the kcat values given protein sequences and substrate structures.
    • (2). Out the Km values given protein sequences and substrate structures.
    • (3). Out the kcat / Km values given protein sequences and substrate structures.
Input_v1 Input_v2 Model Output
MSELMKLSAV...MAQR CC(O)O UniKP for kcat 2.75 s-1
MSELMKLSAV...MAQR CC(O)O UniKP for Km 0.36 mM
MSELMKLSAV...MAQR CC(O)O UniKP for kcat / Km 9.51 s-1 * mM-1

Table of contents

Prerequisites

(Back to top)

Notice:

  • You need download pretrained protein language modoel ProtT5-XL-UniRef50 to generate enzyme representation, the link is provided on ProtT5-XL-U50.
  • You also need download model UniKP for kcat, Km and kcat / Km to predict corresponding kinetic parameters, the link is provided on UniKP_model.

Place these two downloaded models in the UniKP directory.

  • We have included pretrained molecular language modoel SMILES Transformer in this repository to generate substrate representation, the link is also provided on SMILES Transformer.

Usage

(Back to top)

  • For users who want to use the deep learning model for prediction, please run these command lines at the terminal:

    • (1). Download the UniKP package

       git clone https://github.com/Luo-SynBioLab/UniKP
      
    • (2). Create and activate enviroment

       conda create -n Uni_test python=3.7
       conda activate Uni_test
      
    • (3). Download required Python package

       cd UniKP
       pip3 install torch torchvision torchaudio --index-url https://download.pytorch.org/whl/cu113
       pip install -r requirements.txt   
      
  • Example for how to predict enzyme kinetic parameters from enzyme sequences and substrate structures by language model, UniKP:

All predicted values have been logarithmically transformed with a base of 10. Remember to revert the transformation.

import torch
from build_vocab import WordVocab
from pretrain_trfm import TrfmSeq2seq
from utils import split
# build_vocab, pretrain_trfm, utils packages are from SMILES Transformer
from transformers import T5EncoderModel, T5Tokenizer
# transformers package is from ProtTrans
import re
import gc
import numpy as np
import pandas as pd
import pickle
import math


def smiles_to_vec(Smiles):
    pad_index = 0
    unk_index = 1
    eos_index = 2
    sos_index = 3
    mask_index = 4
    vocab = WordVocab.load_vocab('vocab.pkl')
    def get_inputs(sm):
        seq_len = 220
        sm = sm.split()
        if len(sm)>218:
            print('SMILES is too long ({:d})'.format(len(sm)))
            sm = sm[:109]+sm[-109:]
        ids = [vocab.stoi.get(token, unk_index) for token in sm]
        ids = [sos_index] + ids + [eos_index]
        seg = [1]*len(ids)
        padding = [pad_index]*(seq_len - len(ids))
        ids.extend(padding), seg.extend(padding)
        return ids, seg
    def get_array(smiles):
        x_id, x_seg = [], []
        for sm in smiles:
            a,b = get_inputs(sm)
            x_id.append(a)
            x_seg.append(b)
        return torch.tensor(x_id), torch.tensor(x_seg)
    trfm = TrfmSeq2seq(len(vocab), 256, len(vocab), 4)
    trfm.load_state_dict(torch.load('trfm_12_23000.pkl'))
    trfm.eval()
    x_split = [split(sm) for sm in Smiles]
    xid, xseg = get_array(x_split)
    X = trfm.encode(torch.t(xid))
    return X


def Seq_to_vec(Sequence):
    for i in range(len(Sequence)):
        if len(Sequence[i]) > 1000:
            Sequence[i] = Sequence[i][:500] + Sequence[i][-500:]
    sequences_Example = []
    for i in range(len(Sequence)):
        zj = ''
        for j in range(len(Sequence[i]) - 1):
            zj += Sequence[i][j] + ' '
        zj += Sequence[i][-1]
        sequences_Example.append(zj)
    ###### you should place downloaded model into this directory.
    tokenizer = T5Tokenizer.from_pretrained("prot_t5_xl_uniref50", do_lower_case=False)
    model = T5EncoderModel.from_pretrained("prot_t5_xl_uniref50")
    gc.collect()
    print(torch.cuda.is_available())
    # 'cuda:0' if torch.cuda.is_available() else
    device = torch.device('cuda:0' if torch.cuda.is_available() else 'cpu')
    model = model.to(device)
    model = model.eval()
    features = []
    for i in range(len(sequences_Example)):
        print('For sequence ', str(i+1))
        sequences_Example_i = sequences_Example[i]
        sequences_Example_i = [re.sub(r"[UZOB]", "X", sequences_Example_i)]
        ids = tokenizer.batch_encode_plus(sequences_Example_i, add_special_tokens=True, padding=True)
        input_ids = torch.tensor(ids['input_ids']).to(device)
        attention_mask = torch.tensor(ids['attention_mask']).to(device)
        with torch.no_grad():
            embedding = model(input_ids=input_ids, attention_mask=attention_mask)
        embedding = embedding.last_hidden_state.cpu().numpy()
        for seq_num in range(len(embedding)):
            seq_len = (attention_mask[seq_num] == 1).sum()
            seq_emd = embedding[seq_num][:seq_len - 1]
            features.append(seq_emd)
    features_normalize = np.zeros([len(features), len(features[0][0])], dtype=float)
    for i in range(len(features)):
        for k in range(len(features[0][0])):
            for j in range(len(features[i])):
                features_normalize[i][k] += features[i][j][k]
            features_normalize[i][k] /= len(features[i])
    return features_normalize


if __name__ == '__main__':
    sequences = ['MEDIPDTSRPPLKYVKGIPLIKYFAEALESLQDFQAQPDDLLISTYPKSGTTWVSEILDMIYQDGDVEKCRRAPVFIRVPFLEFKA'
                 'PGIPTGLEVLKDTPAPRLIKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYRMAKVHPDPDTWDSFLEKFMAGEVSYGSW'
                 'YQHVQEWWELSHTHPVLYLFYEDMKENPKREIQKILKFVGRSLPEETVDLIVQHTSFKEMKNNSMANYTTLSPDIMDHSISAFMRK'
                 'GISGDWKTTFTVAQNERFDADYAKKMEGCGLSFRTQL']
    Smiles = ['OC1=CC=C(C[C@@H](C(O)=O)N)C=C1']
    seq_vec = Seq_to_vec(sequences)
    smiles_vec = smiles_to_vec(Smiles)
    fused_vector = np.concatenate((smiles_vec, seq_vec), axis=1)

    ###### you should place downloaded model into this directory.
    # For kcat
    with open('UniKP/UniKP for kcat.pkl', "rb") as f:
        model = pickle.load(f)
    # For Km
    # with open('UniKP/UniKP for Km.pkl', "rb") as f:
    #     model = pickle.load(f)
    # For kcat/Km
    # with open('UniKP/UniKP for kcat_Km.pkl', "rb") as f:
    #     model = pickle.load(f)
    
    Pre_label = model.predict(fused_vector)
    Pre_label_pow = [math.pow(10, Pre_label[i]) for i in range(len(Pre_label))]
    print(len(Pre_label_pow))
    res = pd.DataFrame({'sequences': sequences, 'Smiles': Smiles, 'Pre_label': Pre_label_pow})
    res.to_excel('Kinetic_parameters_predicted_label.xlsx')

Development

(Back to top)

Contribute

(Back to top)

  • Shenzhen Institute of Advanced Technology, Chinese Academy of Sciences, Shenzhen 518055, China:
Han Yu Huaxiang Deng Jiahui He Jay D. Keasling Xiaozhou Luo

Sponsor

(Back to top)

We would like to acknowledge the support from National Key R&D Program of China (2018YFA0903200), National Natural Science Foundation of China (32071421), Guangdong Basic and Applied Basic Research Foundation (2021B1515020049), Shenzhen Science and Technology Program (ZDSYS20210623091810032 and JCYJ20220531100207017), and Shenzhen Institute of Synthetic Biology Scientific Research Program (ZTXM20203001).

Adding new features or fixing bugs

(Back to top)

License

(Back to top)

GNU General Public License version 3

Footer

(Back to top)

If you use this code or our models for your publication, please cite the original paper:

Yu, H., Deng, H., He, J. et al. UniKP: a unified framework for the prediction of enzyme kinetic parameters. Nat Commun 14, 8211 (2023). [https://doi.org/10.1038/s41467-023-44113-1]

The preprint version:

Han Yu, Huaxiang Deng, Jiahui He et al. Highly accurate enzyme turnover number prediction and enzyme engineering with PreKcat, 18 May 2023, PREPRINT (Version 1) available at Research Square [https://doi.org/10.21203/rs.3.rs-2749688/v1]

About

No description, website, or topics provided.

Resources

Stars

0 stars

Watchers

0 watching

Forks

Releases

Packages

Contributors

Languages